PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr003262.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 476aa    MW: 54168.7 Da    PI: 6.8468
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr003262.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.77.4e-92904701373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++ Ll  A+av++++   a + L++l +++s  gd++qR++ayf+ +Laarl+   s  y+ +  ++ts    +ee+ a+++++ vsP+++f+h+ta
  Pbr003262.1  90 LIHMLLITATAVNENNVGSALEHLTELYKIVSLCGDSVQRVVAYFADGLAARLLTRKSPFYDMIMKEPTS----EEEFVAFTALYRVSPYYQFAHFTA 183
                  6899***************************************************9999**988887775....78899999**************** PP

         GRAS  99 NqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gvpfefnvlvakrled 188
                  NqaI ea+e+e     +++H+iDfd+s+G+QWp+L+q+L++++  ++  slRiTg+g+    s +el+et++rL++f + + ++ fef+ l    l +
  Pbr003262.1 184 NQAIIEAFEKEqeknnRALHVIDFDVSYGFQWPSLIQSLSEKAssSNRISLRITGFGR----SVDELRETENRLTSFSKGFrNLVFEFQGL----LRS 273
                  *********9977777788***********************95444559********....9****************9758*******8....667 PP

         GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                   +l +Lr k++E++aVnlv++l +l  +++++++    +L+ v  l P +v++veqe + +  sFl rf+e+l+y++a+fdsl+  lp es er ++E
  Pbr003262.1 274 SKLINLRKKRNETIAVNLVFHLNTLS-NNLKISD----LLNSVHLLDPSIVILVEQEGSKSPRSFLSRFMETLHYFAAMFDSLDDCLPLESAERLSIE 366
                  77789*****************9997.5566655....************************************************************ PP

         GRAS 287 rellgreivnvvacegae..rrerhetlekWrerleeaGFkpvplsekaakqaklllr........kvksdg.......yrveee.sgslv.lgWkdr 365
                  +  lg+ei++++   +++     ++e++e+W++++e+ GF+ ++ls+k   qa+lll+        +  +dg       ++v e+ +g  + lgW+dr
  Pbr003262.1 367 KNHLGKEIKSMLNYDNNNdeNCPKTEKMETWKAKMESHGFEGINLSSKSKIQARLLLKirthysplE--FDGssgaaagFKVFERdDGRTIsLGWQDR 462
                  ************8765541277799*******************************97332222211..12222233336665543555557****** PP

         GRAS 366 pLvsvSaW 373
                   L+++SaW
  Pbr003262.1 463 YLLTISAW 470
                  ******** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.29564436IPR005202Transcription factor GRAS
PfamPF035142.5E-8990470IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MEDIDEEEEL LNLSLAIVTS SGRERFKKRK RSRDDGIANS ILVSPLNSYE GCEGKIFRLL  60
QMREQMLKKL DLHKKKGVAF DDEDGKGLHL IHMLLITATA VNENNVGSAL EHLTELYKIV  120
SLCGDSVQRV VAYFADGLAA RLLTRKSPFY DMIMKEPTSE EEFVAFTALY RVSPYYQFAH  180
FTANQAIIEA FEKEQEKNNR ALHVIDFDVS YGFQWPSLIQ SLSEKASSSN RISLRITGFG  240
RSVDELRETE NRLTSFSKGF RNLVFEFQGL LRSSKLINLR KKRNETIAVN LVFHLNTLSN  300
NLKISDLLNS VHLLDPSIVI LVEQEGSKSP RSFLSRFMET LHYFAAMFDS LDDCLPLESA  360
ERLSIEKNHL GKEIKSMLNY DNNNDENCPK TEKMETWKAK MESHGFEGIN LSSKSKIQAR  420
LLLKIRTHYS PLEFDGSSGA AAGFKVFERD DGRTISLGWQ DRYLLTISAW HCTVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-39954718375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12631KKRKRS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009348843.10.0PREDICTED: scarecrow-like protein 23
TrEMBLM5VGL50.0M5VGL5_PRUPE; Uncharacterized protein
STRINGPOPTR_0019s11540.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62002952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.18e-57GRAS family protein